Cat: CBMOAB-34757FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34757FYA |
Specificity | This antibody binds to Rhesus AADAT. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus AADAT (clone MO34757FYA) Antibody (CBMOAB-34757FYA) is a mouse antibody against AADAT. It can be used for AADAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Mitochondrial kynurenine/alpha-aminoadipate aminotransferase; AADAT |
UniProt ID | G8HS42 |
Protein Refseq | The length of the protein is 35 amino acids long. The sequence is show below: LAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMG. |
See other products for " AADAT "
CBMOAB-34755FYA | Mouse Anti-Rhesus AADAT Antibody (CBMOAB-34755FYA) |
MO-AB-01114H | Mouse Anti-Frog aadat Antibody (MO-AB-01114H) |
CBMOAB-34756FYA | Mouse Anti-Rhesus AADAT Antibody (CBMOAB-34756FYA) |
MO-AB-06728R | Mouse Anti-Cattle AADAT Antibody (MO-AB-06728R) |
MO-AB-21218W | Mouse Anti-Chimpanzee AADAT Antibody (MO-AB-21218W) |
MO-AB-06729R | Mouse Anti-Cattle AADAT Antibody (MO-AB-06729R) |
MO-AB-01113H | Mouse Anti-Frog aadat Antibody (MO-AB-01113H) |
MO-AB-50156W | Mouse Anti-Marmoset AADAT Antibody (MO-AB-50156W) |
For Research Use Only | Not For Clinical Use.