Mouse Anti-Rhesus AAMDC (clone MO34759FYA) Antibody (CBMOAB-34759FYA)


Cat: CBMOAB-34759FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34759FYA
SpecificityThis antibody binds to Rhesus AAMDC.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay play a role in preadipocyte differentiation and adipogenesis.
Product OverviewMouse Anti-Rhesus AAMDC (clone MO34759FYA) Antibody (CBMOAB-34759FYA) is a mouse antibody against AAMDC. It can be used for AAMDC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAAMDC
UniProt IDF6R6I3
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKAPTQQMPSDVHVGAVVEFHLATASWHILERCKTG.
For Research Use Only | Not For Clinical Use.

Online Inquiry