Cat: CBMOAB-34790FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34790FYA |
Specificity | This antibody binds to Rhesus ABCA7. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This full transporter has been detected predominantly in myelo-lymphatic tissues with the highest expression in peripheral leukocytes, thymus, spleen, and bone marrow. The function of this protein is not yet known; however, the expression pattern suggests a role in lipid homeostasis in cells of the immune system. |
Product Overview | Mouse Anti-Rhesus ABCA7 (clone MO34790FYA) Antibody (CBMOAB-34790FYA) is a mouse antibody against ABCA7. It can be used for ABCA7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette sub-family A member 7; ABCA7 |
UniProt ID | H9FDH8 |
Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: WYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTQLDPKVLVEEAPPGLSPGVSVRGLEKHF. |
See other products for " ABCA7 "
CBMOAB-34789FYA | Mouse Anti-Rhesus ABCA7 Antibody (CBMOAB-34789FYA) |
CBMOAB-34792FYA | Mouse Anti-Rhesus ABCA7 Antibody (CBMOAB-34792FYA) |
CBMOAB-1258FYC | Mouse Anti-Arabidopsis ABCA7 Antibody (CBMOAB-1258FYC) |
CBMOAB-34791FYA | Mouse Anti-Rhesus ABCA7 Antibody (CBMOAB-34791FYA) |
For Research Use Only | Not For Clinical Use.