Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rhesus ABCA7 Antibody (CBMOAB-34792FYA)


Cat: CBMOAB-34792FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34792FYA
SpecificityThis antibody binds to Rhesus ABCA7.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This full transporter has been detected predominantly in myelo-lymphatic tissues with the highest expression in peripheral leukocytes, thymus, spleen, and bone marrow. The function of this protein is not yet known; however, the expression pattern suggests a role in lipid homeostasis in cells of the immune system.
Product OverviewMouse Anti-Rhesus ABCA7 (clone MO34792FYA) Antibody (CBMOAB-34792FYA) is a mouse antibody against ABCA7. It can be used for ABCA7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette sub-family A member 7; ABCA7
UniProt IDH9FF58
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: DSSLSPACSELIGALDNHPLSRLLWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELALLRDVQEVWEVLGPRIFTFMNDSSNVAMLQRLLQIQDEGRRQPTPGGQDRMEALRSFLDPGSGGYSWQDA.
For Research Use Only | Not For Clinical Use.

Online Inquiry