Mouse Anti-Rhesus ABCA7 Antibody (CBMOAB-34792FYA)


Cat: CBMOAB-34792FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34792FYA
SpecificityThis antibody binds to Rhesus ABCA7.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This full transporter has been detected predominantly in myelo-lymphatic tissues with the highest expression in peripheral leukocytes, thymus, spleen, and bone marrow. The function of this protein is not yet known; however, the expression pattern suggests a role in lipid homeostasis in cells of the immune system.
Product OverviewMouse Anti-Rhesus ABCA7 (clone MO34792FYA) Antibody (CBMOAB-34792FYA) is a mouse antibody against ABCA7. It can be used for ABCA7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette sub-family A member 7; ABCA7
UniProt IDH9FF58
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: DSSLSPACSELIGALDNHPLSRLLWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELALLRDVQEVWEVLGPRIFTFMNDSSNVAMLQRLLQIQDEGRRQPTPGGQDRMEALRSFLDPGSGGYSWQDA.
For Research Use Only | Not For Clinical Use.

Online Inquiry