Mouse Anti-Rhesus ABCA8 Antibody (CBMOAB-34794FYA)


Cat: CBMOAB-34794FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34794FYA
SpecificityThis antibody binds to Rhesus ABCA8.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. The encoded protein may regulate lipid metabolism and be involved in the formation and maintenance of myelin. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus ABCA8 (clone MO34794FYA) Antibody (CBMOAB-34794FYA) is a mouse antibody against ABCA8. It can be used for ABCA8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABCA8
UniProt IDF7BWB8
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: LLFNFQLLHLDYDLNSNAFPHPLDGSNIIVATNFMLAFDTCLYLALAIYFEKILPNEYGHRRSPLFFLKSSFWSQTQKADHVALEDEMDADPSSHDSFEPVPPEFHGKEAIRIRNVTKEYKGKPDKIEALKDLVFDIYEGQITAIVTVELESQHC.
For Research Use Only | Not For Clinical Use.

Online Inquiry