Mouse Anti-Rhesus ABCB9 Antibody (CBMOAB-34814FYA)


Cat: CBMOAB-34814FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34814FYA
SpecificityThis antibody binds to Rhesus ABCB9.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This family member functions in the translocation of peptides from the cytosol into the lysosomal lumen. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specificities.
Product OverviewMouse Anti-Rhesus ABCB9 (clone MO34814FYA) Antibody (CBMOAB-34814FYA) is a mouse antibody against ABCB9. It can be used for ABCB9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABCB9
UniProt IDF7GK16
Protein RefseqThe length of the protein is 453 amino acids long.
The sequence is show below: SQGRPLRPRASLGVACHRPSRRLGPRCRSCSPTLSPTWPSSWPPLSSSSWQLWERPSCPTTRAEPLTASSSRKAWISSARLSPSCACWPLAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGCLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSGNLIAFIIYEFVLGDCMENVSFSLCPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLVSHRAVGNAGAGAAPGGQSPHHPADGC.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry