Cat: CBMOAB-34817FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34817FYA |
Specificity | This antibody binds to Rhesus ABCC10. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This ABC full-transporter is a member of the MRP subfamily which is involved in multi-drug resistance. Multiple transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus ABCC10 (clone MO34817FYA) Antibody (CBMOAB-34817FYA) is a mouse antibody against ABCC10. It can be used for ABCC10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Multidrug resistance-associated protein 7 isoform MRP7; ABCC10 |
UniProt ID | H9FCY5 |
Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: ELHGALFSWGPVGTSQETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGRVVVWGLSKGFGLATQEPW. |
See other products for " ABCC10 "
MO-AB-50199W | Mouse Anti-Marmoset ABCC10 Antibody (MO-AB-50199W) |
CBMOAB-34818FYA | Mouse Anti-Rhesus ABCC10 Antibody (CBMOAB-34818FYA) |
MO-AB-16708W | Mouse Anti-Chimpanzee ABCC10 Antibody (MO-AB-16708W) |
MO-AB-50197W | Mouse Anti-Marmoset ABCC10 Antibody (MO-AB-50197W) |
CBMOAB-34819FYA | Mouse Anti-Rhesus ABCC10 Antibody (CBMOAB-34819FYA) |
CBMOAB-34816FYA | Mouse Anti-Rhesus ABCC10 Antibody (CBMOAB-34816FYA) |
MO-AB-50198W | Mouse Anti-Marmoset ABCC10 Antibody (MO-AB-50198W) |
CBMOAB-1292FYC | Mouse Anti-Arabidopsis ABCC10 Antibody (CBMOAB-1292FYC) |
For Research Use Only | Not For Clinical Use.