Mouse Anti-Rhesus ABCC10 Antibody (CBMOAB-34817FYA)


Cat: CBMOAB-34817FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34817FYA
SpecificityThis antibody binds to Rhesus ABCC10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This ABC full-transporter is a member of the MRP subfamily which is involved in multi-drug resistance. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus ABCC10 (clone MO34817FYA) Antibody (CBMOAB-34817FYA) is a mouse antibody against ABCC10. It can be used for ABCC10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMultidrug resistance-associated protein 7 isoform MRP7; ABCC10
UniProt IDH9FCY5
Protein RefseqThe length of the protein is 76 amino acids long.
The sequence is show below: ELHGALFSWGPVGTSQETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGRVVVWGLSKGFGLATQEPW.
For Research Use Only | Not For Clinical Use.

Online Inquiry