Cat: CBMOAB-34823FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34823FYA |
Specificity | This antibody binds to Rhesus Abcc13. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the superfamily of genes encoding ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This family member is part of the MRP subfamily, which is involved in multi-drug resistance, but the human locus is now thought to be a pseudogene incapable of encoding a functional ABC protein. Alternative splicing results in multiple transcript variants; however, not all variants have been fully described. |
Product Overview | Mouse Anti-Rhesus Abcc13 (clone MO34823FYA) Antibody (CBMOAB-34823FYA) is a mouse antibody against Abcc13. It can be used for Abcc13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette sub-family C member 13; Abcc13 |
UniProt ID | Q6VBM5 |
Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: QKFSTGEIINLMSADAQQLMDLTANLNLLWSAPFQILMAIYLLWQELGPAVLAGVAVLVFV. |
Reference
See other products for " abcc13 "
CBMOAB-64370FYA | Mouse Anti-Zebrafish abcc13 Antibody (CBMOAB-64370FYA) |
CBMOAB-34821FYA | Mouse Anti-Rhesus ABCC13 Antibody (CBMOAB-34821FYA) |
MO-AB-43546W | Mouse Anti-Horse Abcc13 Antibody (MO-AB-43546W) |
CBMOAB-64371FYA | Mouse Anti-Zebrafish abcc13 Antibody (CBMOAB-64371FYA) |
MO-AB-23446R | Mouse Anti-Pig ABCC13 Antibody (MO-AB-23446R) |
CBMOAB-1295FYC | Mouse Anti-Arabidopsis ABCC13 Antibody (CBMOAB-1295FYC) |
CBMOAB-34822FYA | Mouse Anti-Rhesus ABCC13 Antibody (CBMOAB-34822FYA) |
For Research Use Only | Not For Clinical Use.