Mouse Anti-Rhesus ABCC2 Antibody (CBMOAB-34827FYA)


Cat: CBMOAB-34827FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34827FYA
SpecificityThis antibody binds to Rhesus ABCC2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia.
Product OverviewMouse Anti-Rhesus ABCC2 (clone MO34827FYA) Antibody (CBMOAB-34827FYA) is a mouse antibody against ABCC2. It can be used for ABCC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCanalicular multispecific organic anion transporter 1; ABCC2
UniProt IDH9FHG6
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: SIYLEYLRAVGFFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPKSQRDMRLGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRIVNRFAGDISTVDDTLPQSMRSWVTCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQIFYVS.
For Research Use Only | Not For Clinical Use.

Online Inquiry