Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rhesus ABCC2 Antibody (CBMOAB-34827FYA)


Cat: CBMOAB-34827FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34827FYA
SpecificityThis antibody binds to Rhesus ABCC2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia.
Product OverviewMouse Anti-Rhesus ABCC2 (clone MO34827FYA) Antibody (CBMOAB-34827FYA) is a mouse antibody against ABCC2. It can be used for ABCC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCanalicular multispecific organic anion transporter 1; ABCC2
UniProt IDH9FHG6
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: SIYLEYLRAVGFFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPKSQRDMRLGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRIVNRFAGDISTVDDTLPQSMRSWVTCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQIFYVS.
For Research Use Only | Not For Clinical Use.

Online Inquiry