Cat: CBMOAB-34828FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO34828FYA |
| Specificity | This antibody binds to Rhesus ABCC2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. |
| Product Overview | Mouse Anti-Rhesus ABCC2 (clone MO34828FYA) Antibody (CBMOAB-34828FYA) is a mouse antibody against ABCC2. It can be used for ABCC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Canalicular multispecific organic anion transporter 1; ABCC2 |
| UniProt ID | H9FJV9 |
| Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: TEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYSRQWCIQKNSWFLSLFWVLSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQ. |
See other products for " abcc2 "
| MO-AB-42898W | Mouse Anti-Hamsters abcc2 Antibody (MO-AB-42898W) |
| MO-AB-32797H | Mouse Anti-Nile tilapia ABCC2 Antibody (MO-AB-32797H) |
| MO-AB-07043Y | Mouse Anti-Rabbit ABCC2 Antibody (MO-AB-07043Y) |
| CBMOAB-64375FYA | Mouse Anti-Zebrafish abcc2 Antibody (CBMOAB-64375FYA) |
| CBMOAB-64373FYA | Mouse Anti-Zebrafish abcc2 Antibody (CBMOAB-64373FYA) |
| CBMOAB-64374FYA | Mouse Anti-Zebrafish abcc2 Antibody (CBMOAB-64374FYA) |
| CBMOAB-64372FYA | Mouse Anti-Zebrafish abcc2 Antibody (CBMOAB-64372FYA) |
| CBMOAB-1299FYC | Mouse Anti-Arabidopsis ABCC2 Antibody (CBMOAB-1299FYC) |
| CBMOAB-34827FYA | Mouse Anti-Rhesus ABCC2 Antibody (CBMOAB-34827FYA) |
| CBMOAB-34826FYA | Mouse Anti-Rhesus ABCC2 Antibody (CBMOAB-34826FYA) |
For Research Use Only | Not For Clinical Use.