Mouse Anti-Rhesus ABCC4 Antibody (MO-AB-00868W)
Cat: MO-AB-00868W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO00868W |
Specificity | This antibody binds to Rhesus ABCC4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR / TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants. |
Product Overview | Mouse Anti-Rhesus ABCC4 Antibody is a mouse antibody against ABCC4. It can be used for ABCC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Multidrug resistance-associated protein 4 isoform 1; ABCC4 |
UniProt ID | H9FGD9 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: DSVALNTAYAYATVLTVCTLILAILHHLYFYHVQCAGMRLRIAMCHMIYRKALRLSNMAMGKTTTGQ. |
See other products for " Abcc4 "
MO-AB-10593Y | Mouse Anti-O. mykiss Abcc4 Antibody (MO-AB-10593Y) |
MO-AB-06756R | Mouse Anti-Cattle ABCC4 Antibody (MO-AB-06756R) |
CBMOAB-64380FYA | Mouse Anti-Zebrafish abcc4 Antibody (CBMOAB-64380FYA) |
MO-AB-20105W | Mouse Anti-Chimpanzee ABCC4 Antibody (MO-AB-20105W) |
CBMOAB-1301FYC | Mouse Anti-Arabidopsis ABCC4 Antibody (CBMOAB-1301FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry