Cat: CBMOAB-34830FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34830FYA |
Specificity | This antibody binds to Rhesus ABCC8. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene. |
Product Overview | Mouse Anti-Rhesus ABCC8 (clone MO34830FYA) Antibody (CBMOAB-34830FYA) is a mouse antibody against ABCC8. It can be used for ABCC8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette sub-family C member 8; ABCC8 |
UniProt ID | H9FGR8 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: VNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNTFIKTAHKKPIDLRAIGKLPIAMRA. |
See other products for " abcc8 "
CBMOAB-64390FYA | Mouse Anti-Zebrafish abcc8 Antibody (CBMOAB-64390FYA) |
CBMOAB-1305FYC | Mouse Anti-Arabidopsis ABCC8 Antibody (CBMOAB-1305FYC) |
CBMOAB-34831FYA | Mouse Anti-Rhesus ABCC8 Antibody (CBMOAB-34831FYA) |
CBMOAB-64388FYA | Mouse Anti-Zebrafish abcc8 Antibody (CBMOAB-64388FYA) |
CBMOAB-64386FYA | Mouse Anti-Zebrafish abcc8 Antibody (CBMOAB-64386FYA) |
CBMOAB-64389FYA | Mouse Anti-Zebrafish abcc8 Antibody (CBMOAB-64389FYA) |
CBMOAB-64387FYA | Mouse Anti-Zebrafish abcc8 Antibody (CBMOAB-64387FYA) |
MO-NAB-00040W | Mouse Anti-ABCC8 (AA 1548-1582, clone NW0157) Antibody (MO-NAB-00040W) |
CBMOAB-64385FYA | Mouse Anti-Zebrafish abcc8 Antibody (CBMOAB-64385FYA) |
MO-AB-50203W | Mouse Anti-Marmoset ABCC8 Antibody (MO-AB-50203W) |
For Research Use Only | Not For Clinical Use.