Cat: CBMOAB-34834FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34834FYA |
Specificity | This antibody binds to Rhesus ABCC9. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extra-pancreatic ATP-sensitive potassium channels. Mutations in this gene are associated with cardiomyopathy dilated type 1O. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Rhesus ABCC9 (clone MO34834FYA) Antibody (CBMOAB-34834FYA) is a mouse antibody against ABCC9. It can be used for ABCC9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette sub-family C member 9 isoform SUR2B; ABCC9 |
UniProt ID | H9FJM7 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: LFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILTADLVIVMKRGNILEYD. |
See other products for " ABCC9 "
MO-AB-07045Y | Mouse Anti-Rabbit ABCC9 Antibody (MO-AB-07045Y) |
CBMOAB-64392FYA | Mouse Anti-Zebrafish abcc9 Antibody (CBMOAB-64392FYA) |
CBMOAB-34835FYA | Mouse Anti-Rhesus ABCC9 Antibody (CBMOAB-34835FYA) |
CBMOAB-1306FYC | Mouse Anti-Arabidopsis ABCC9 Antibody (CBMOAB-1306FYC) |
MO-AB-50205W | Mouse Anti-Marmoset ABCC9 Antibody (MO-AB-50205W) |
CBMOAB-64393FYA | Mouse Anti-Zebrafish abcc9 Antibody (CBMOAB-64393FYA) |
CBMOAB-34832FYA | Mouse Anti-Rhesus ABCC9 Antibody (CBMOAB-34832FYA) |
CBMOAB-34833FYA | Mouse Anti-Rhesus ABCC9 Antibody (CBMOAB-34833FYA) |
CBMOAB-64391FYA | Mouse Anti-Zebrafish abcc9 Antibody (CBMOAB-64391FYA) |
MO-AB-50204W | Mouse Anti-Marmoset ABCC9 Antibody (MO-AB-50204W) |
For Research Use Only | Not For Clinical Use.