Mouse Anti-Rhesus ABHD6 Antibody (CBMOAB-34870FYA)


Cat: CBMOAB-34870FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34870FYA
SpecificityThis antibody binds to Rhesus ABHD6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Lysosome; Plasma Membrane; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionLipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol (PubMed:22969151). Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways. May also have a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids (By similarity).
Product OverviewMouse Anti-Rhesus ABHD6 (clone MO34870FYA) Antibody (CBMOAB-34870FYA) is a mouse antibody against ABHD6. It can be used for ABHD6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABHD6
UniProt IDF7HIR3
Protein RefseqThe length of the protein is 318 amino acids long.
The sequence is show below: MDVDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQDSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADVGQVNCQLPGGASGKLWALGSDGDPGRQPSS.
For Research Use Only | Not For Clinical Use.

Online Inquiry