Mouse Anti-Rhesus ABLIM1 Antibody (CBMOAB-34886FYA)


Cat: CBMOAB-34886FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34886FYA
SpecificityThis antibody binds to Rhesus ABLIM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a LIM zinc-binding domain-containing protein that binds to actin filaments and mediates interactions between actin and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Rhesus ABLIM1 (clone MO34886FYA) Antibody (CBMOAB-34886FYA) is a mouse antibody against ABLIM1. It can be used for ABLIM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABLIM1
UniProt IDF6YH97
Protein RefseqThe length of the protein is 403 amino acids long.
The sequence is show below: MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGEVIHSSGCELCLEGYQDVRDRMIHRSTSQGSISSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEEIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAAVGPDMRRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASYIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRESNTLPDGHMPAMRMDRGVSMPNMLEPKASIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDKLPLWRRNDMKKKAKLF.

Reference

See other products for " ABLIM1 "

CBMOAB-34884FYAMouse Anti-Rhesus ABLIM1 Antibody (CBMOAB-34884FYA)
MO-AB-00885WMouse Anti-Rhesus ABLIM1 Antibody (MO-AB-00885W)
CBMOAB-34883FYAMouse Anti-Rhesus ABLIM1 Antibody (CBMOAB-34883FYA)
MO-AB-00886WMouse Anti-Rhesus ABLIM1 Antibody (MO-AB-00886W)
CBMOAB-34885FYAMouse Anti-Rhesus ABLIM1 Antibody (CBMOAB-34885FYA)
MO-AB-06814RMouse Anti-Cattle ABLIM1 Antibody (MO-AB-06814R)
MO-AB-01148HMouse Anti-Frog ablim1 Antibody (MO-AB-01148H)
CBMOAB-34882FYAMouse Anti-Rhesus ABLIM1 Antibody (CBMOAB-34882FYA)
CBMOAB-34887FYAMouse Anti-Rhesus ABLIM1 Antibody (CBMOAB-34887FYA)
For Research Use Only | Not For Clinical Use.

Online Inquiry