Mouse Anti-Rhesus ABLIM3 Antibody (CBMOAB-34890FYA)


Cat: CBMOAB-34890FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34890FYA
SpecificityThis antibody binds to Rhesus ABLIM3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the actin-binding LIM (abLIM) family of proteins. These proteins are characterized by an N-terminal LIM domain and a C-terminal dematin-like domain. The encoded protein interacts with actin filaments and may be a component of adherens junctions in several cell types. A variant of this gene may be associated with pain sensitivity in male human patients.
Product OverviewMouse Anti-Rhesus ABLIM3 (clone MO34890FYA) Antibody (CBMOAB-34890FYA) is a mouse antibody against ABLIM3. It can be used for ABLIM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABLIM3
UniProt IDF6YHN6
Protein RefseqThe length of the protein is 438 amino acids long.
The sequence is show below: CAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPAYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF.

See other products for " ablim3 "

CBMOAB-64520FYAMouse Anti-Zebrafish ablim3 Antibody (CBMOAB-64520FYA)
CBMOAB-64525FYAMouse Anti-Zebrafish ablim3 Antibody (CBMOAB-64525FYA)
CBMOAB-64521FYAMouse Anti-Zebrafish ablim3 Antibody (CBMOAB-64521FYA)
MO-AB-21179WMouse Anti-Chimpanzee ABLIM3 Antibody (MO-AB-21179W)
CBMOAB-64524FYAMouse Anti-Zebrafish ablim3 Antibody (CBMOAB-64524FYA)
CBMOAB-64522FYAMouse Anti-Zebrafish ablim3 Antibody (CBMOAB-64522FYA)
CBMOAB-34892FYAMouse Anti-Rhesus ABLIM3 Antibody (CBMOAB-34892FYA)
CBMOAB-64519FYAMouse Anti-Zebrafish ablim3 Antibody (CBMOAB-64519FYA)
MO-AB-50265WMouse Anti-Marmoset ABLIM3 Antibody (MO-AB-50265W)
CBMOAB-34893FYAMouse Anti-Rhesus ABLIM3 Antibody (CBMOAB-34893FYA)
For Research Use Only | Not For Clinical Use.

Online Inquiry