Mouse Anti-Rhesus ACAD10 Antibody (CBMOAB-34911FYA)


Cat: CBMOAB-34911FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34911FYA
SpecificityThis antibody binds to Rhesus ACAD10.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Product OverviewMouse Anti-Rhesus ACAD10 (clone MO34911FYA) Antibody (CBMOAB-34911FYA) is a mouse antibody against ACAD10. It can be used for ACAD10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACAD10
UniProt IDF6US95
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: MCVRSCFQSSCLQWAWRTAFLKHIQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMSKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVVVESCVEGICKPDPRIYKLCLERLGLQPSESIFLDDLGPNVKAAASLGIHTIKVNDPETAVKELEALLGFTLRLGVPNTQPVRKTMEIPKDSLKKYLKDLLGIQTTGL.
For Research Use Only | Not For Clinical Use.

Online Inquiry