Mouse Anti-Rhesus ACAD8 Antibody (CBMOAB-34914FYA)


Cat: CBMOAB-34914FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34914FYA
SpecificityThis antibody binds to Rhesus ACAD8.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.
Product OverviewMouse Anti-Rhesus ACAD8 (clone MO34914FYA) Antibody (CBMOAB-34914FYA) is a mouse antibody against ACAD8. It can be used for ACAD8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIsobutyryl-CoA dehydrogenase, mitochondrial; ACAD8
UniProt IDH9F5X7
Protein RefseqThe length of the protein is 400 amino acids long.
The sequence is show below: LPGGLRALVQTGHRSLSSCIDPSLGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYVQTDVGGSGLSRLDTSVIFEALATGCTSTTAYMSIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGGGESDIYVVMCRTGGPGPKGISCVVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPLANRIGDEGQGFLIAVKGLNGGRINIASCSLGAAHASVILTRDHLKVRKQFGEPLASNQYLQFMLADMATRLVAARLMIRNAAVALQEERKEAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYMRDSRVHQILEGSNEVMRMLISRSLLQE.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry