Mouse Anti-Rhesus ACADSB Antibody (CBMOAB-34924FYA)


Cat: CBMOAB-34924FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34924FYA
SpecificityThis antibody binds to Rhesus ACADSB.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionShort/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-KDa.
Product OverviewMouse Anti-Rhesus ACADSB (clone MO34924FYA) Antibody (CBMOAB-34924FYA) is a mouse antibody against ACADSB. It can be used for ACADSB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACADSB
UniProt IDF7EM89
Protein RefseqThe length of the protein is 170 amino acids long.
The sequence is show below: KKFLSPPAMVWRPSQPYGTLRRNFPTCLSSWKIPPHVSKSSQSEALLDITNNGLHLAPLQTLTDEEMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSIIQGLFQQGLMGIEVDPKYGGTGASFLSTVIVIEELAKVDASVAVFCEVQNTLINTMIRKHGTEEQKATYLPQ.
For Research Use Only | Not For Clinical Use.

Online Inquiry