Mouse Anti-Rhesus ACN9 Antibody (CBMOAB-34962FYA)


Cat: CBMOAB-34962FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34962FYA
SpecificityThis antibody binds to Rhesus ACN9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit sdhb of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.
Product OverviewMouse Anti-Rhesus ACN9 Antibody is a mouse antibody against ACN9. It can be used for ACN9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein ACN9 homolog, mitochondrial; ACN9
UniProt IDH9FXE6
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MPGRHISRVRALYKRVLQLHRVLPPDLKALGDQYVKDEFRRHKSVGSDEAQRFLQEWEVYATVLSQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESTKPKF.
See other products for " acn9 "
For Research Use Only | Not For Clinical Use.
Online Inquiry