Mouse Anti-Rhesus AHSG Antibody (CBMOAB-35369FYA)


Cat: CBMOAB-35369FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO35369FYA
SpecificityThis antibody binds to Rhesus AHSG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness.
Product OverviewMouse Anti-Rhesus AHSG Antibody is a mouse antibody against AHSG. It can be used for AHSG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAHSG
UniProt IDF6WRS6
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: MKSLVLLLCLARLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAVDYINQNLPWGYKHTLNQIDEVKVWPQQPFGEMFEIEIDTLETTCHVLDPTPVAGCRVRQLKEHAVEGDCDFQLLKVNGKFSVEYAKCDSSPDSAEDVRKVCRDCPLLAPLNDTRVVHAAEAAVTAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTISGTDCVAKEATEAANCNLLAKKQYGFCKATLNEKLGGEEVAVTCTVFQTQPATSQPQPEGANEAVPTPVVDADAPASYPVGASGPLPTGSPIYAHVLAAAPPVVPIHSSHYDLRHLFMGVVSLRSPSGEALHPRKTRSVVQPSVGAAAGPVVPPCPGRVRHFKV.
See other products for " AHSG "
MO-AB-23647RMouse Anti-Pig AHSG Antibody (MO-AB-23647R)
MOFY-0722-FY354Rabbit Anti-AHSG Antibody (MOFY-0722-FY354)
MO-AB-01309HMouse Anti-Frog ahsg Antibody (MO-AB-01309H)
MOFY-0722-FY426Rabbit Anti-AHSG Antibody (MOFY-0722-FY426)
MO-AB-14146YMouse Anti-Sheep AHSG Antibody (MO-AB-14146Y)
MO-AB-07125YMouse Anti-Rabbit AHSG Antibody (MO-AB-07125Y)
MOFY-0722-FY138Rabbit Anti-AHSG Antibody (MOFY-0722-FY138)
MOFY-0722-FY271Rabbit Anti-AHSG Antibody (MOFY-0722-FY271)
MO-AB-07156RMouse Anti-Cattle AHSG Antibody (MO-AB-07156R)
MO-AB-41202WMouse Anti-Guinea pig AHSG Antibody (MO-AB-41202W)
For Research Use Only | Not For Clinical Use.
Online Inquiry