Mouse Anti-Rhesus AMN Antibody (CBMOAB-35603FYA)


Cat: CBMOAB-35603FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO35603FYA
SpecificityThis antibody binds to Rhesus AMN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a type I transmembrane protein. It is thought to modulate bone morphogenetic protein (BMP) receptor function by serving as an accessory or coreceptor, and thus facilitates or hinders BMP binding. It is known that the mouse AMN gene is expressed in the extraembryonic visceral endoderm layer during gastrulation, but it is found to be mutated in amnionless mouse. The encoded protein has sequence similarity to short gastrulation (Sog) and procollagen IIA proteins in Drosophila.
Product OverviewMouse Anti-Rhesus AMN Antibody is a mouse antibody against AMN. It can be used for AMN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein amnionless; AMN
UniProt IDH9FD13
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: HLWRSENEAPSLFFVDAERVPCRHDDVVFPPSASFRVGLGPGAGPVRVRSISALGRTFTRDEDLAAFLASRAGRLRFHGPGALSVGPEDCADPSGCVCGNAEAQPWICADLPQSLGVRCPQAACHGALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLGLPQYQGLQVAVSKVPRSPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry