Cat: CBMOAB-35987FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO35987FYA |
Specificity | This antibody binds to Rhesus APC2. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a strongly conserved protein that has an N-terminal coiled-coil domain followed by an armadillo domain, five 20-amino acid repeats, and two SAMP domains. This protein promotes the assembly of a multiprotein complex that recruits and phosphorylates the Wnt effector beta-catenin and targets beta-catenin for ubiquitylation and proteasomal degradation. This protein therefore plays a role in the reduction of cytoplasmic levels of beta-catenin which in turn reduces activation of Wnt target genes that play a pivotal role in the pathogenesis of various human cancers. The protein encoded by this gene is closely related to the adenomatous polyposis coli (APC) tumor-suppressor protein and has similar tumor-suppressor effects. This gene also plays a role in actin assembly, cell-cell adhesion, and microtubule network formation through its interaction with cytoskeletal proteins. This gene has its highest expression in the central nervous system and is involved in brain development through cytoskeletal regulation in neurons. Alternative splicing produces multiple transcript variants encoding distinct isoforms. |
Product Overview | Mouse Anti-Rhesus APC2 (clone MO35987FYA) Antibody (CBMOAB-35987FYA) is a mouse antibody against APC2. It can be used for APC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenomatous polyposis coli protein 2; APC2 |
UniProt ID | H9FH36 |
Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: GTEAGPGARGGRLGLVRVASALSSGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASAPQGTSPRRGRPALPAVF. |
See other products for " APC2 "
MO-AB-23784R | Mouse Anti-Pig APC2 Antibody (MO-AB-23784R) |
CBMOAB-66105FYA | Mouse Anti-Zebrafish apc2 Antibody (CBMOAB-66105FYA) |
CBMOAB-00246CR | Mouse Anti-Yeast APC2 Antibody (CBMOAB-00246CR) |
CBMOAB-35986FYA | Mouse Anti-Rhesus APC2 Antibody (CBMOAB-35986FYA) |
MO-DKB-02296W | Rabbit Anti-APC2 Antibody (MO-DKB-02296W) |
MO-AB-00070H | Mouse Anti-Arabidopsis APC2 Antibody (MO-AB-00070H) |
MO-AB-03375W | Mouse Anti-Rhesus APC2 Antibody (MO-AB-03375W) |
CBMOAB-66104FYA | Mouse Anti-Zebrafish apc2 Antibody (CBMOAB-66104FYA) |
CBMOAB-2256FYC | Mouse Anti-Arabidopsis APC2 Antibody (CBMOAB-2256FYC) |
CBMOAB-01095FYA | Mouse Anti-D. melanogaster Apc2 Antibody (CBMOAB-01095FYA) |
For Research Use Only | Not For Clinical Use.