Mouse Anti-Rhesus BAK1 Antibody (CBMOAB-36763FYA)


Cat: CBMOAB-36763FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO36763FYA
SpecificityThis antibody binds to Rhesus BAK1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
Product OverviewMouse Anti-Rhesus BAK1 (clone MO36763FYA) Antibody (CBMOAB-36763FYA) is a mouse antibody against BAK1. It can be used for BAK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBAK1
UniProt IDH9H5R7
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS.
For Research Use Only | Not For Clinical Use.

Online Inquiry