Mouse Anti-Rhesus BRD4 Antibody (CBMOAB-37097FYA)


Cat: CBMOAB-37097FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO37097FYA
SpecificityThis antibody binds to Rhesus BRD4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
Product OverviewMouse Anti-Rhesus BRD4 (clone MO37097FYA) Antibody (CBMOAB-37097FYA) is a mouse antibody against BRD4. It can be used for BRD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBromodomain-containing protein 4 isoform long; BRD4
UniProt IDH9FIQ0
Protein RefseqThe length of the protein is 182 amino acids long.
The sequence is show below: QSPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQPPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPL.
For Research Use Only | Not For Clinical Use.

Online Inquiry