Mouse Anti-Rhesus CCL1 Antibody (CBMOAB-38536FYA)
Cat: CBMOAB-38536FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO38536FYA |
Specificity | This antibody binds to Rhesus CCL1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCL1 (C-C Motif Chemokine Ligand 1) is a Protein Coding gene. Diseases associated with CCL1 include Igg4-Related Sclerosing Cholangitis and Tolosa-Hunt Syndrome. Among its related pathways are PEDF Induced Signaling and Aryl Hydrocarbon Receptor. Gene Ontology (GO) annotations related to this gene include cytokine activity and chemokine activity. |
Product Overview | Mouse Anti-Rhesus CCL1 Antibody is a mouse antibody against CCL1. It can be used for CCL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | C-C motif chemokine; CCL1 |
UniProt ID | F6Y0Z6 |
Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: VQVPFSRCCFLFVEKEISLRAIQCYRNTSSSCSNEGLIFKLKRGNEACALNQARWVQNHIKKLSHCLPKRK. |
See other products for " Ccl1 "
MO-AB-24571H | Mouse Anti-Rat Ccl1 Antibody (MO-AB-24571H) |
MO-AB-01015Y | Mouse Anti-Chicken CCL1 Antibody (MO-AB-01015Y) |
CBMOAB-00629CR | Mouse Anti-Yeast CCL1 Antibody (CBMOAB-00629CR) |
MO-AB-03481W | Mouse Anti-Rhesus CCL1 Antibody (MO-AB-03481W) |
MO-AB-29397W | Mouse Anti-Dog CCL1 Antibody (MO-AB-29397W) |
MO-AB-24368R | Mouse Anti-Pig CCL1 Antibody (MO-AB-24368R) |
MO-AB-22151W | Mouse Anti-Chimpanzee CCL1 Antibody (MO-AB-22151W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry