Mouse Anti-Rhesus CCR2 Antibody (CBMOAB-38586FYA)


Cat: CBMOAB-38586FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38586FYA
SpecificityThis antibody binds to Rhesus CCR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCR2 (C-C Motif Chemokine Receptor 2) is a Protein Coding gene. Diseases associated with CCR2 include Idiopathic Anterior Uveitis and Cd3zeta Deficiency. Among its related pathways are Cytokine Signaling in Immune system and Defensins. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is CCR5.
Product OverviewMouse Anti-Rhesus CCR2 Antibody is a mouse antibody against CCR2. It can be used for CCR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C chemokine receptor type 2; CCR2
UniProt IDF7BY78
Protein RefseqThe length of the protein is 366 amino acids long.
The sequence is show below: MLSTSRSRFIRNTNGSGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKSLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQEEDSVYICGPYFPRGWNNFHTIMRNILGLMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL.
See other products for " CCR2 "
MO-AB-34172WMouse Anti-Donkey CCR2 Antibody (MO-AB-34172W)
MO-AB-34254HMouse Anti-Tomato CCR2 Antibody (MO-AB-34254H)
MO-AB-02184HMouse Anti-Frog ccr2 Antibody (MO-AB-02184H)
MO-AB-43950WMouse Anti-Horse CCR2 Antibody (MO-AB-43950W)
MO-AB-47718WMouse Anti-Maize ccr2 Antibody (MO-AB-47718W)
CBMOAB-25854FYCMouse Anti-Arabidopsis CCR2 Antibody (CBMOAB-25854FYC)
MO-AB-08436WMouse Anti-Cat CCR2 Antibody (MO-AB-08436W)
MO-AB-24406RMouse Anti-Pig CCR2 Antibody (MO-AB-24406R)
For Research Use Only | Not For Clinical Use.
Online Inquiry