Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rhesus CD163 Antibody (MO-AB-01554W)


Cat: MO-AB-01554W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01554W
SpecificityThis antibody binds to Rhesus CD163.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD163 (CD163 Molecule) is a Protein Coding gene. Diseases associated with CD163 include Rosai-Dorfman Disease and Non-Langerhans-Cell Histiocytosis. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Binding and Uptake of Ligands by Scavenger Receptors. Gene Ontology (GO) annotations related to this gene include scavenger receptor activity. An important paralog of this gene is CD163L1.
Product OverviewMouse Anti-Rhesus CD163 (clone MO01554W) Antibody (MO-AB-01554W) is a mouse antibody against CD163. It can be used for CD163 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesScavenger receptor cysteine-rich type 1 protein M130 isoform a; CD163
UniProt IDH9FFW9
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: AGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSDLEMRLTNGGNKCSGRIEIKFQGQWGTVCDDNFNIDHASVVCKQLECGSAVSFSGSANFGEG.
For Research Use Only | Not For Clinical Use.

Online Inquiry