Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rhesus CD209 Antibody (CBMOAB-38663FYA)


Cat: CBMOAB-38663FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38663FYA
SpecificityThis antibody binds to Rhesus CD209.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD209 (CD209 Molecule) is a Protein Coding gene. Diseases associated with CD209 include Dengue Virus and Human Immunodeficiency Virus Type 1. Among its related pathways are CLEC7A (Dectin-1) signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include carbohydrate binding and mannose binding. An important paralog of this gene is CLEC4M.
Product OverviewMouse Anti-Rhesus CD209 (clone MO38663FYA) Antibody (CBMOAB-38663FYA) is a mouse antibody against CD209. It can be used for CD209 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD209 antigen; CD209
UniProt IDF7AAT4
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MSDSKEPRLQQLGLLEEEQLGGVGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSLRSRESSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPAPTTPNPPPE.
For Research Use Only | Not For Clinical Use.

Online Inquiry