Mouse Anti-Rhesus CD209 Antibody (CBMOAB-38664FYA)


Cat: CBMOAB-38664FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38664FYA
SpecificityThis antibody binds to Rhesus CD209.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD209 (CD209 Molecule) is a Protein Coding gene. Diseases associated with CD209 include Dengue Virus and Human Immunodeficiency Virus Type 1. Among its related pathways are CLEC7A (Dectin-1) signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include carbohydrate binding and mannose binding. An important paralog of this gene is CLEC4M.
Product OverviewMouse Anti-Rhesus CD209 (clone MO38664FYA) Antibody (CBMOAB-38664FYA) is a mouse antibody against CD209. It can be used for CD209 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD209 antigen; CD209
UniProt IDF7AAV0
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MSDSKEPRLQQLGLLEEEQLGGVGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSLIALQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPAPTTPNPPPE.
For Research Use Only | Not For Clinical Use.

Online Inquiry