Mouse Anti-Rhesus CD274 Antibody (CBMOAB-38680FYA)


Cat: CBMOAB-38680FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38680FYA
SpecificityThis antibody binds to Rhesus CD274.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Plasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD274, also known as PDL1, is a ligand that binds to the receptor PD1. It is usually found on T cells and acts to block T cell activation.
Product OverviewMouse Anti-Rhesus CD274 Antibody is a mouse antibody against CD274. It can be used for CD274 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD274
UniProt IDF6PJN1
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MRIFAVFIFTIYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGD.
See other products for " CD274 "
MO-AB-09803RMouse Anti-Cattle CD274 Antibody (MO-AB-09803R)
MO-AB-52544WMouse Anti-Marmoset CD274 Antibody (MO-AB-52544W)
MO-AB-29456WMouse Anti-Dog CD274 Antibody (MO-AB-29456W)
MO-AB-22638WMouse Anti-Chimpanzee CD274 Antibody (MO-AB-22638W)
MO-AB-70616WMouse Anti-CD274 Antibody (MO-AB-70616W)
For Research Use Only | Not For Clinical Use.
Online Inquiry