Mouse Anti-Rhesus CD276 Antibody (CBMOAB-38681FYA)


Cat: CBMOAB-38681FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38681FYA
SpecificityThis antibody binds to Rhesus CD276.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD276 (CD276 Molecule) is a Protein Coding gene. Diseases associated with CD276 include Neuroblastoma and Acute Cervicitis. Among its related pathways are T Cell Co-Signaling Pathway: Ligand-Receptor Interactions and NF-kappaB Signaling. Gene Ontology (GO) annotations related to this gene include receptor binding. An important paralog of this gene is LOC102723996.
Product OverviewMouse Anti-Rhesus CD276 Antibody is a mouse antibody against CD276. It can be used for CD276 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD276
UniProt IDF7G5V3
Protein RefseqThe length of the protein is 534 amino acids long.
The sequence is show below: MLHRRGSPGMGVHVGAALGALWFCLTGALEIQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLVALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQELA.

Reference

Reference1. Gaya, A., & Tse, V. (2012). A preclinical and clinical review of aflibercept for the management of cancer. Cancer treatment reviews, 38(5), 484-493.
2. Rhodes, D. A., Reith, W., & Trowsdale, J. (2016). Regulation of immunity by butyrophilins. Annual review of immunology, 34, 151-172.
For Research Use Only | Not For Clinical Use.
Online Inquiry