Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rhesus CD40 Antibody (MO-AB-01561W)


Cat: MO-AB-01561W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01561W
SpecificityThis antibody binds to Rhesus CD40.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD40 (CD40 Molecule) is a Protein Coding gene. Diseases associated with CD40 include Immunodeficiency With Hyper-Igm, Type 3 and Cd40 Ligand Deficiency. Among its related pathways are NLR Proteins and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include enzyme binding and receptor activity. An important paralog of this gene is TNFRSF11A.
Product OverviewMouse Anti-Rhesus CD40 (clone MO01561W) Antibody (MO-AB-01561W) is a mouse antibody against CD40. It can be used for CD40 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTumor necrosis factor receptor superfamily member 5 isoform 1; CD40
UniProt IDH9ZFM8
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MVRLPLQCVLWGCLLTAVYPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQRALVVIPICLGILFVILLLVLVFIKKVAKKPNDKAPHPKQEPQEINFLDDLPGSNPAAPVQETLHGCQPVTQEDGKESRISVQERQ.
For Research Use Only | Not For Clinical Use.

Online Inquiry