Mouse Anti-Rhesus CD8A Antibody (CBMOAB-38745FYA)


Cat: CBMOAB-38745FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38745FYA
SpecificityThis antibody binds to Rhesus CD8A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD8A (CD8a Molecule) is a Protein Coding gene. Diseases associated with CD8A include Cd8 Deficiency, Familial and Primary Cutaneous Aggressive Epidermotropic Cd8+ T-Cell Lymphoma. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and T-Cell Receptor and Co-stimulatory Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and coreceptor activity.
Product OverviewMouse Anti-Rhesus CD8A Antibody is a mouse antibody against CD8A. It can be used for CD8A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD8A
UniProt IDF7DXL7
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MAPPVTALLLPLVLLLHAARPNQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRSPTPAPTTASQPLSLRPEACRPAAGGSVNTRGLDFACDIYIWAPLAGACGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSDRYV.

Reference

ReferenceMavigner, M., Brooks, A., Mattingly, C., Vanderford, T., Keele, B., Lifson, J., ... & Chahroudi, A. (2019). The latency reversal activity of the SMAC mimetic AZD5582 in ART-suppressed SIV-infected rhesus macaques is potentiated by CD8a cell depletion. Journal of Virus Eradication.
For Research Use Only | Not For Clinical Use.
Online Inquiry