AibGenesis™ Mouse Anti-DNAJC24 Antibody (CBMOAB-40985FYA)


Cat: CBMOAB-40985FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40985FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO40985FYA 100 µg
CBMOAB-73845FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73845FYA 100 µg
MO-AB-11553R Monoclonal Cattle (Bos taurus) WB, ELISA MO11553R 100 µg
MO-AB-20471W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20471W 100 µg
MO-AB-25445H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25445C 100 µg
MO-AB-54363W Monoclonal Marmoset WB, ELISA MO54363W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO40985FYA
SpecificityThis antibody binds to Rhesus DNAJC24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DNAJC24 Antibody is a mouse antibody against DNAJC24. It can be used for DNAJC24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNAJC24
UniProt IDF7GXE9
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: YHPDKQSTDVSAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNIGPVDAQVYLEEMSWNEDDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry