Cat: CBMOAB-41010FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO41010FYA |
Specificity | This antibody binds to Rhesus DND1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that binds to microRNA-targeting sequences of mRNAs, inhibiting microRNA-mediated repression. Reduced expression of this gene has been implicated in tongue squamous cell carcinoma. Two pseudogenes of this gene are located on the long arm of chromosome 17. |
Product Overview | Mouse Anti-Rhesus DND1 (clone MO41010FYA) Antibody (CBMOAB-41010FYA) is a mouse antibody against DND1. It can be used for DND1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Dead end protein homolog 1; DND1 |
UniProt ID | H9FAX8 |
Protein Refseq | The length of the protein is 33 amino acids long. The sequence is show below: KDAVSVRLLQALSESGASLLWSAGAEAGTMVKQ. |
See other products for " DND1 "
CBMOAB-27758FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-27758FYC) |
CBMOAB-27757FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-27757FYC) |
CBMOAB-27762FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-27762FYC) |
CBMOAB-73894FYA | Mouse Anti-Zebrafish dnd1 Antibody (CBMOAB-73894FYA) |
CBMOAB-0973FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-0973FYC) |
CBMOAB-27763FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-27763FYC) |
CBMOAB-27760FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-27760FYC) |
CBMOAB-27759FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-27759FYC) |
CBMOAB-41011FYA | Mouse Anti-Rhesus DND1 Antibody (CBMOAB-41011FYA) |
CBMOAB-27761FYC | Mouse Anti-Arabidopsis DND1 Antibody (CBMOAB-27761FYC) |
For Research Use Only | Not For Clinical Use.