Mouse Anti-FAM184B Antibody (CBMOAB-42350FYA)


Cat: CBMOAB-42350FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42350FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO42350FYA 100 µg
CBMOAB-75856FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75856FYA 100 µg
MO-AB-03694W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03694W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO42350FYA
SpecificityThis antibody binds to Rhesus FAM184B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM184B Antibody is a mouse antibody against FAM184B. It can be used for FAM184B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM184B; FAM184B
UniProt IDH9FEJ3
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: VSQALWQWQEKESDLRKNFQVQESALQAQVRKLEGDLEHRGRKISDLKKYAQKLKERIQDLDVQLKEARQENSELKGTAKKLGEKLAVAKDRMMLQECRGTQKTDARKTELVSENKVLGEENDLEASNLHPQHDQSCLKECPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry