Mouse Anti-Rhesus FGB Antibody (CBMOAB-42831FYA)


Cat: CBMOAB-42831FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO42831FYA
SpecificityThis antibody binds to Rhesus FGB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus FGB Antibody is a mouse antibody against FGB. It can be used for FGB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFGB
UniProt IDF7HBS1
Protein RefseqThe length of the protein is 272 amino acids long.
The sequence is show below: MEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWNPYKQGFGNIATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLTGENRTMTIHNGMFFSTYDRDNDGWLTADPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGKYTWDMAKHGTDDGVVWMNWKGSWYSMKKMSMKIRPFFPQQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry