Mouse Anti-Rhesus GLB1 Antibody (CBMOAB-43633FYA)


Cat: CBMOAB-43633FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO43633FYA
SpecificityThis antibody binds to Rhesus GLB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the glycosyl hydrolase 35 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature lysosomal enzyme. This enzyme catalyzes the hydrolysis of a terminal beta-linked galactose residue from ganglioside substrates and other glycoconjugates. Mutations in this gene may result in GM1-gangliosidosis and Morquio B syndrome.
Product OverviewMouse Anti-Rhesus GLB1 Antibody is a mouse antibody against GLB1. It can be used for GLB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGLB1
UniProt IDF7GKD1
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: NATRRVFEIAYSQDRFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNTIQTYVPWNFHESWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKEAILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPIITVQVENEYGSYFACDFDYLRFLQKRFHHHLGDDVVLFTTDGAHETFLQCGALQGLYTTVDFGPGCNITDAFQIQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEVVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNVIQK.
See other products for " GLB1 "
MO-AB-56047WMouse Anti-Marmoset GLB1 Antibody (MO-AB-56047W)
MO-AB-33243HMouse Anti-Nile tilapia glb1 Antibody (MO-AB-33243H)
MO-AB-34836WMouse Anti-Ferret GLB1 Antibody (MO-AB-34836W)
MO-AB-08203WMouse Anti-Cat GLB1 Antibody (MO-AB-08203W)
MO-NAB-00157WHuman Anti-E. coli GLB1 Antibody (MO-NAB-00157W)
MO-AB-41733WMouse Anti-Guinea pig GLB1 Antibody (MO-AB-41733W)
CBMOAB-34050FYCMouse Anti-Arabidopsis GLB1 Antibody (CBMOAB-34050FYC)
MO-AB-30958WMouse Anti-Dog GLB1 Antibody (MO-AB-30958W)
MO-AB-34539HMouse Anti-Tomato GLB1 Antibody (MO-AB-34539H)
MO-AB-23259HMouse Anti-Mallard GLB1 Antibody (MO-AB-23259H)
For Research Use Only | Not For Clinical Use.
Online Inquiry