AibGenesis™ Mouse Anti-GOLPH3L Antibody (CBMOAB-43822FYA)


Cat: CBMOAB-43822FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43822FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43822FYA 100 µg
CBMOAB-78281FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78281FYA 100 µg
MO-AB-13212R Monoclonal Cattle (Bos taurus) WB, ELISA MO13212R 100 µg
MO-AB-25782W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25782W 100 µg
MO-AB-56185W Monoclonal Marmoset WB, ELISA MO56185W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO43822FYA
SpecificityThis antibody binds to Rhesus GOLPH3L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. (From NCBI)
Product OverviewMouse Anti-Rhesus GOLPH3L Antibody is a mouse antibody against GOLPH3L. It can be used for GOLPH3L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGOLPH3L
UniProt IDF7BLQ4
Protein RefseqThe length of the protein is 268 amino acids long.
The sequence is show below: MTTLTHRARRTEVSKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKESNINNWIQWLTPVIPALWGAEGYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKY.
For Research Use Only | Not For Clinical Use.
Online Inquiry