Mouse Anti-Rhesus GSTO1 Antibody (CBMOAB-60166FYC)


Cat: CBMOAB-60166FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO60166FYC
SpecificityThis antibody binds to Rhesus GSTO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGSTO1 (Glutathione S-Transferase Omega 1) is a Protein Coding gene. Diseases associated with GSTO1 include Barrett's Adenocarcinoma and Hepatocellular Carcinoma. Among its related pathways are arsenate detoxification I (glutaredoxin) and Drug metabolism - cytochrome P450. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and glutathione dehydrogenase (ascorbate) activity. An important paralog of this gene is GSTO2.
Product OverviewMouse Anti-Rhesus GSTO1 Antibody is a mouse antibody against GSTO1. It can be used for GSTO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase omega-1 isoform 1; GSTO1
UniProt IDH9F480
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: VPEGSIRVYSMRFCPFAERTLLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESPITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLYECVDHTPKLKLWMAAMKEDPTVSALLISGKDWQGFLELYLQNSPEACDYGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry