Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rhesus ICAM3 Antibody (CBMOAB-45007FYA)


Cat: CBMOAB-45007FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO45007FYA
SpecificityThis antibody binds to Rhesus ICAM3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus ICAM3 (clone MO45007FYA) Antibody (CBMOAB-45007FYA) is a mouse antibody against ICAM3. It can be used for ICAM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntercellular adhesion molecule 3; ICAM3
UniProt IDH9FEP1
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: LRVLYGPKIDRATCPQHLKWKDKTRHVLQCQARGNPYPQLRCLKEGSNREVPVGIPFFVNVTHNGTYQCQASSSQGKYTLVVVMDIEAPKSHFVPVFLAVLVTLGVVTVVVALMYVFREHKRSGRYHVRQESTSLPLTSMQPTEAMGE.
For Research Use Only | Not For Clinical Use.

Online Inquiry