AibGenesis™ Mouse Anti-IER3IP1 Antibody (CBMOAB-45036FYA)
Cat: CBMOAB-45036FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45036FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO45036FYA | 100 µg | ||
| CBMOAB-80269FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80269FYA | 100 µg | ||
| MO-AB-11973W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11973W | 100 µg | ||
| MO-AB-13955R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13955R | 100 µg | ||
| MO-AB-26422H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26422C | 100 µg | ||
| MO-AB-37457W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37457W | 100 µg | ||
| MO-AB-57120W | Monoclonal | Marmoset | WB, ELISA | MO57120W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO45036FYA |
| Specificity | This antibody binds to Rhesus IER3IP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a small protein that is localized to the endoplasmic reticulum (ER) and may play a role in the ER stress response by mediating cell differentiation and apoptosis. Transcription of this gene is regulated by tumor necrosis factor alpha and specificity protein 1 (Sp1). Mutations in this gene may play a role in microcephaly, epilepsy, and diabetes syndrome (MEDS), and a pseudogene of this gene is located on the long arm of chromosome 12. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus IER3IP1 Antibody is a mouse antibody against IER3IP1. It can be used for IER3IP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Immediate early response 3-interacting protein 1; IER3IP1 |
| UniProt ID | I0FSA0 |
| Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: MASTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGVDGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry