Mouse Anti-Rhesus ITGAM Antibody (MO-AB-03868W)


Cat: MO-AB-03868W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO03868W
SpecificityThis antibody binds to Rhesus ITGAM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus ITGAM Antibody is a mouse antibody against ITGAM. It can be used for ITGAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin alpha-M isoform 1; ITGAM
UniProt IDH9FFC5
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: HTDFLAKLRKDPVVNCSIAVCQRIKCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLVVSTAEIMFNNSTFTLLPGQGAFVRAQTETKVELFEVPNPLPLIVGSSLGGLLLLALITAALYKLGFFKRQYKDMMSDG.
See other products for " ITGAM "
MOFY-0522-FY38Mouse Anti-ITGAM Antibody (MOFY-0522-FY38)
CBMOAB-81258FYAMouse Anti-Zebrafish itgam Antibody (CBMOAB-81258FYA)
MO-AB-26742RMouse Anti-Pig Itgam Antibody (MO-AB-26742R)
CBMOAB-00173FYAMouse Anti-Rabbit ITGAM Antibody (CBMOAB-00173FYA)
MO-AB-41893WMouse Anti-Guinea pig ITGAM Antibody (MO-AB-41893W)
CBMOAB-00017FYAMouse Anti-Cattle ITGAM Antibody (CBMOAB-00017FYA)
CBMOAB-00016FYAMouse Anti-Cattle ITGAM Antibody (CBMOAB-00016FYA)
MO-DKB-00397WRabbit Anti-ITGAM Antibody (MO-DKB-00397W)
MO-AB-14327RMouse Anti-Cattle ITGAM Antibody (MO-AB-14327R)
MOFY-0522-FY47Rat Anti-ITGAM Antibody (MOFY-0522-FY47)
For Research Use Only | Not For Clinical Use.
Online Inquiry