Mouse Anti-Rhesus ITGB1 Antibody (MO-AB-03869W)


Cat: MO-AB-03869W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO03869W
SpecificityThis antibody binds to Rhesus ITGB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIntegrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus ITGB1 Antibody is a mouse antibody against ITGB1. It can be used for ITGB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin Subunit Beta 1
UniProt IDF7EUS3
Protein RefseqThe length of the protein is 78 amino acids long.
The sequence is show below: PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry