Mouse Anti-Rhesus ITGB1 Antibody (MO-AB-03869W)
Cat: MO-AB-03869W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO03869W |
Specificity | This antibody binds to Rhesus ITGB1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Plasma membrane |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus ITGB1 Antibody is a mouse antibody against ITGB1. It can be used for ITGB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Integrin Subunit Beta 1 |
UniProt ID | F7EUS3 |
Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK. |
See other products for " ITGB1 "
MO-AB-00678L | Mouse Anti-Elephant ITGB1 Antibody (MO-AB-00678L) |
MO-DKB-03622W | Rabbit Anti-ITGB1 (AA 1-250, clone ms2109-030) Antibody (Cat MO-DKB-03622W) |
MO-AB-45201W | Mouse Anti-Horse ITGB1 Antibody (MO-AB-45201W) |
MO-AB-02604Y | Mouse Anti-Chicken ITGB1 Antibody (MO-AB-02604Y) |
MO-NAB-00430W | Rabbit Anti-ITGB1 Antibody (AA 21-250) |
MO-AB-41894W | Mouse Anti-Guinea pig ITGB1 Antibody (MO-AB-41894W) |
MO-AB-35005W | Mouse Anti-Ferret ITGB1 Antibody (MO-AB-35005W) |
MO-AB-57416W | Mouse Anti-Marmoset ITGB1 Antibody (MO-AB-57416W) |
MO-AB-23333H | Mouse Anti-Mallard ITGB1 Antibody (MO-AB-23333H) |
CBMOAB-00263FYA | Rabbit Anti-Mouse ITGB1 Antibody (CBMOAB-00263FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry