Mouse Anti-KIR3DL3 Antibody (CBMOAB-46405FYA)


Cat: CBMOAB-46405FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46405FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO46405FYA 100 µg
MO-AB-14603R Monoclonal Cattle (Bos taurus) WB, ELISA MO14603R 100 µg
MO-AB-24138W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24138W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO46405FYA
SpecificityThis antibody binds to Rhesus KIR3DL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KIR3DL3 Antibody is a mouse antibody against KIR3DL3. It can be used for KIR3DL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKIR3DL3
UniProt IDB9VJU7
Protein RefseqThe length of the protein is 344 amino acids long.
The sequence is show below: YTGGQDKTSLSARPSALVPQGGHVTLRCHYRRGLYNFTNFTLYKDDRSHVPIFPGRIFQESFLMGPVTPAHAGTYRCRGSYPHSPTEWSALSDPLAIRVTGVHKKPSLLALPGPLVKSGETVTLQCSSDTVFEHFFLHREVTFEEPLHLVGERHGGGSQVNYSINSTTSDLAETYRCYGSATHSPYVLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSQTSFDMYHLSREGEANELRLPAVSSVNGTFQANFLLGPATHGGTYRCFGSYRDSPYEWSDPSDPLSVSVTGNPSRSWPSPTEPSSKTSIPRHLHVLIGTSVVMILFTIFFFLLHRW.
For Research Use Only | Not For Clinical Use.
Online Inquiry