AibGenesis™ Mouse Anti-KPNA3 Antibody (CBMOAB-46584FYA)


Cat: CBMOAB-46584FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46584FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO46584FYA 100 µg
CBMOAB-82222FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82222FYA 100 µg
MO-AB-00808R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00808R 100 µg
MO-AB-02685Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02685Y 100 µg
MO-AB-04735H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04735C 100 µg
MO-AB-06601Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06601Y 100 µg
MO-AB-08646Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08646Y 100 µg
MO-AB-11762W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11762W 100 µg
MO-AB-15931Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15931Y 100 µg
MO-AB-26927R Monoclonal Pig (Sus scrofa) WB, ELISA MO26927R 100 µg
MO-AB-31532W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31532W 100 µg
MO-AB-35035W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35035W 100 µg
MO-AB-41994W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41994W 100 µg
MO-AB-57964W Monoclonal Marmoset WB, ELISA MO57964W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO46584FYA
SpecificityThis antibody binds to Rhesus KPNA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. (From NCBI)
Product OverviewMouse Anti-Rhesus KPNA3 Antibody is a mouse antibody against KPNA3. It can be used for KPNA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesImportin subunit alpha; KPNA3
UniProt IDF7D176
Protein RefseqThe length of the protein is 520 amino acids long.
The sequence is show below: MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGKSGLIEIFEHWNSETLVLVNLVERKLLGYVIDEDPCPFPEATQGGTYNFDPTANLQTKEFNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry