Mouse Anti-LHFPL2 Antibody (CBMOAB-46912FYA)


Cat: CBMOAB-46912FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46912FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO46912FYA 100 µg
CBMOAB-82682FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82682FYA 100 µg
MO-AB-14511W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14511W 100 µg
MO-AB-14914R Monoclonal Cattle (Bos taurus) WB, ELISA MO14914R 100 µg
MO-AB-26790H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26790C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO46912FYA
SpecificityThis antibody binds to Rhesus LHFPL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LHFPL2 Antibody is a mouse antibody against LHFPL2. It can be used for LHFPL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLipoma HMGIC fusion partner-like 2 protein; LHFPL2
UniProt IDH9F9U1
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: ESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry