AibGenesis™ Mouse Anti-LRRC28 Antibody (CBMOAB-49199FYA)


Cat: CBMOAB-49199FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49199FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO49199FYA 100 µg
CBMOAB-85438FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85438FYA 100 µg
MO-AB-08727Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08727Y 100 µg
MO-AB-13558W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13558W 100 µg
MO-AB-15068R Monoclonal Cattle (Bos taurus) WB, ELISA MO15068R 100 µg
MO-AB-58358W Monoclonal Marmoset WB, ELISA MO58358W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO49199FYA
SpecificityThis antibody binds to Rhesus LRRC28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRC28 Antibody is a mouse antibody against LRRC28. It can be used for LRRC28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRC28
UniProt IDF7C2Y8
Protein RefseqThe length of the protein is 312 amino acids long.
The sequence is show below: MASELCKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQYLERLYMKRNSLTTLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLANNQLQFLPPEVGDLKELQTLDISTNRLLTLPERLHMCLSLQYLTVDRNRLWYVPRHLCQLPSLNELSMAGNRLAFLPLDLGRSRELQYVYVDNNIHLKGLPSYLYNKVIGCSGCGAPIQVSEVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRSLYHTYHSLLKGGQLLVLWLTAAPPSVCRLLTC.
For Research Use Only | Not For Clinical Use.
Online Inquiry