AibGenesis™ Mouse Anti-MPV17L2 Antibody (CBMOAB-51663FYA)


Cat: CBMOAB-51663FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51663FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51663FYA 100 µg
CBMOAB-87296FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87296FYA 100 µg
MO-AB-05286H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05286C 100 µg
MO-AB-13335W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13335W 100 µg
MO-AB-15952R Monoclonal Cattle (Bos taurus) WB, ELISA MO15952R 100 µg
MO-AB-27169H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27169C 100 µg
MO-AB-35138W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35138W 100 µg
MO-AB-59286W Monoclonal Marmoset WB, ELISA MO59286W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51663FYA
SpecificityThis antibody binds to Rhesus MPV17L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MPV17L2 Antibody is a mouse antibody against MPV17L2. It can be used for MPV17L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMPV17L2
UniProt IDF6Z5U8
Protein RefseqThe length of the protein is 287 amino acids long.
The sequence is show below: MFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGRLVRVACCTVRELPFRAPPISSHLHQRPDAGLGHVPVVLEVPEPSSSDIPRLCGPGHPSRLNCPPPGLDARLTPGRPSPLPEGEWAPAASSGPGPRPSATPAPGHWAEPSFPSALLGLSFPNWNTPVKMDDHPLALLSRNLIRPVTKMSHLGLSTGLTLPTSPKPQPLNTAVHLALGQATDPELPQVLGLRRGCGRSPQSRLRPGVGPQKFQAGPGSLCVSFPGRELWKCH.
For Research Use Only | Not For Clinical Use.
Online Inquiry